Primary Antibodies

View as table Download

Rabbit polyclonal anti-RHOD antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RHOD.

Rabbit Polyclonal Anti-RHOD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOD antibody: synthetic peptide directed towards the N terminal of human RHOD. Synthetic peptide located within the following region: TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF

Rabbit Polyclonal Anti-RHOD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOD antibody: synthetic peptide directed towards the C terminal of human RHOD. Synthetic peptide located within the following region: NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG