Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 Antibody: A synthesized peptide derived from human EPN2

Epsin 2 (EPN2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-EPN2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPN2.

Rabbit polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM

Rabbit polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN