Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PDXK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDXK Antibody: synthetic peptide directed towards the middle region of human PDXK. Synthetic peptide located within the following region: RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN

Rabbit Polyclonal Anti-PDXK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDXK Antibody: synthetic peptide directed towards the N terminal of human PDXK. Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK