Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF

INPP5K Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated