Rabbit polyclonal anti-HIBADH antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human HIBADH. |
Rabbit polyclonal anti-HIBADH antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human HIBADH. |
Rabbit Polyclonal Anti-HIBADH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIBADH antibody: synthetic peptide directed towards the middle region of human HIBADH. Synthetic peptide located within the following region: AKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMG |
Rabbit Polyclonal Anti-HIBADH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIBADH antibody: synthetic peptide directed towards the middle region of human HIBADH. Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL |
Anti-HIBADH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 314-326 amino acids of Human 3-hydroxyisobutyrate dehydrogenase |