Primary Antibodies

Jump to Filters
View as table Download
GDAP1L1 Rabbit Polyclonal Antibody
TA338643

USD 375.00

5 Days

Rabbit Polyclonal Anti-GDAP1L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GDAP1L1 antibody: synthetic peptide directed towards the N terminal of human GDAP1L1. Synthetic peptide located within the following region: ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT
GDAP1L1 Rabbit Polyclonal Antibody
TA360494

USD 360.00

5 Days

GDAP1L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GDAP1L1