Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RAB5C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB5C antibody: synthetic peptide directed towards the middle region of human RAB5C. Synthetic peptide located within the following region: KTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCS

Anti-RAB5C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-17 amino acids of Human Ras-related protein Rab-5C

Rabbit polyclonal anti-RAB5C antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAB5C.

Anti-RAB5C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-17 amino acids of Human Ras-related protein Rab-5C

RAB5C Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-216 of human RAB5C (NP_958842.1).
Modifications Unmodified