TNFSF18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFSF18 |
TNFSF18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFSF18 |
TNFSF18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFSF18 |
Rabbit Polyclonal GITRL Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | GITRL antibody was raised against purified recombinant human GITR ligand. |
Anti-Human AITRL Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human AITRL |
Rabbit Polyclonal Anti-TNFSF18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFSF18 antibody: synthetic peptide directed towards the middle region of human TNFSF18. Synthetic peptide located within the following region: KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN |
TNFSF18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFSF18 |
TNFSF18 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFSF18 |