Primary Antibodies

Jump to Filters
View as table Download
MED6 Rabbit Polyclonal Antibody
TA335713

USD 375.00

5 Days

Rabbit Polyclonal Anti-MED6 Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN
MED6 Rabbit Polyclonal Antibody
TA365100

USD 380.00

4 Weeks

MED6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein
MED6 Rabbit Polyclonal Antibody
TA369421

USD 380.00

4 Weeks

MED6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein