Primary Antibodies

Jump to Filters
View as table Download
PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody
TA343090

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS
PIP5K1 alpha (PIP5K1A) Rabbit Polyclonal Antibody
TA379961

USD 220.00

3 Weeks

PIP5K1A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 231-500 of human PIP5K1A (NP_001129109.1).
Modifications Unmodified