Rabbit Polyclonal Anti-RAD21 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN |
Rabbit Polyclonal Anti-RAD21 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG |
Rad21 Rabbit polyclonal Antibody
| Applications | ChIP, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Rad21 . |
Germany
Japan
United Kingdom
China