Primary Antibodies

Jump to Filters
View as table Download
LPP Rabbit Polyclonal Antibody
TA335709

USD 375.00

5 Days

Rabbit Polyclonal Anti-LPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPP Antibody: synthetic peptide directed towards the N terminal of human LPP. Synthetic peptide located within the following region: GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST
LPP Rabbit Polyclonal Antibody
TA351364

USD 345.00

In Stock

Rabbit Polyclonal Anti-LPP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPP
Lpp Rabbit Polyclonal Antibody
TA362942

USD 360.00

5 Days

LPP Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse LPP
LPP Rabbit Polyclonal Antibody
TA367124

USD 380.00

4 Weeks

LPP rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LPP