Primary Antibodies

View as table Download

Rabbit Polyclonal RFX-AP Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFX-AP antibody: RFXAP (Regulatory factor X-associated protein), using the recombinant protein.

Rabbit Polyclonal Anti-Rfxap Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rfxap antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: CTYEGCRETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALGSGGPSA

Rabbit Polyclonal Anti-Rfxap Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rfxap antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DAEDEAGDDDADLLDTSDPAGGGESAASPEELEDEDAEGGGAARRRGSKT

Rabbit Polyclonal Anti-RFXAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RFXAP Antibody: synthetic peptide directed towards the middle region of human RFXAP. Synthetic peptide located within the following region: SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLE

RFXAP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RFXAP

RFXAP Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-272 of human RFXAP (NP_000529.1).
Modifications Unmodified