Rabbit Polyclonal antibody to TCP1 epsilon (chaperonin containing TCP1, subunit 5 (epsilon))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 89 and 338 of TCP1 epsilon (Uniprot ID#P48643) |
Rabbit Polyclonal antibody to TCP1 epsilon (chaperonin containing TCP1, subunit 5 (epsilon))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 264 of TCP1 epsilon (Uniprot ID#P48643) |
Rabbit polyclonal anti-CCT5 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCT5. |
Rabbit Polyclonal Anti-CCT5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCT5 antibody: synthetic peptide directed towards the N terminal of human CCT5. Synthetic peptide located within the following region: NDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAE |
Rabbit Polyclonal Anti-CCT5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCT5 antibody: synthetic peptide directed towards the C terminal of human CCT5. Synthetic peptide located within the following region: DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE |
CCT5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CCT5 |
CCT5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CCT5 (NP_036205.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
