Primary Antibodies

View as table Download

CLDN3 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CLDN3

Rabbit polyclonal anti-Claudin 3 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 3.

Rabbit Polyclonal Anti-Claudin 3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 3 Antibody: A synthesized peptide derived from human Claudin 3

Rabbit polyclonal Claudin 3 (Tyr219) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Claudin 3 around the phosphorylation site of tyrosine 219 (R-K-D-YP-V).
Modifications Phospho-specific

Rabbit Polyclonal anti-Cldn3 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cldn3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP

Rabbit anti Claudin 3 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-CLDN3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 207-220 amino acids of Human claudin 3

Anti-CLDN3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 207-220 amino acids of Human claudin 4

CLDN3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 141-220 of human CLDN3 (NP_001297.1).
Modifications Unmodified

Claudin 3 Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human
Conjugation Unconjugated