Rabbit polyclonal CNIH2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CNIH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 31-59 amino acids from the N-terminal region of human CNIH2. |
Rabbit Polyclonal Anti-CNIH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNIH2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNIH2. Synthetic peptide located within the following region: AFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKN |
Rabbit Polyclonal Anti-CNIH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CNIH2 Antibody is: synthetic peptide directed towards the C-terminal region of Human CNIH2. Synthetic peptide located within the following region: LWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLY |
Germany
Japan
United Kingdom
China
