Rabbit Polyclonal Anti-LSS Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSS antibody: synthetic peptide directed towards the N terminal of human LSS. Synthetic peptide located within the following region: TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL |
Rabbit Polyclonal Anti-LSS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSS antibody: synthetic peptide directed towards the middle region of human LSS. Synthetic peptide located within the following region: KCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSE |
LSS Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human LSS (NP_002331.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
