Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MAFK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAFK antibody: synthetic peptide directed towards the N terminal of human MAFK. Synthetic peptide located within the following region: KEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY

Mafk Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated