Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-NDUFB10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFB10. |
Primary Antibodies
View as table Download
Rabbit polyclonal NDUFB10 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NDUFB10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-70 amino acids from the Central region of human NDUFB10. |
Rabbit Polyclonal Anti-NDUFB10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL |
NDUFB10 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
NDUFB10 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human NDUFB10 (NP_004539.1). |
| Modifications | Unmodified |
NDUFB10 Rabbit monoclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NDUFB10
Antibody Hosts
- Rabbit