Germany
Japan
United Kingdom
China
Rabbit Polyclonal antibody to NEGR1 (neuronal growth regulator 1)
| Applications | IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 82 and 354 of NEGR1 (Uniprot ID#Q7Z3B1) |
Primary Antibodies
View as table Download
Rabbit polyclonal Anti-NEGR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEGR1 antibody: synthetic peptide directed towards the N terminal of human NEGR1. Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV |
NEGR1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NEGR1 |
Active filters
Target Symbol
- NEGR1
Antibody Hosts
- Rabbit