Primary Antibodies

Jump to Filters
View as table Download
NXNL2 (Center) Rabbit Polyclonal Antibody
AP52978PU-N

USD 450.00

2 Weeks

NXNL2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 87-116 amino acids from the Central region of human NXNL2
NXNL2 Rabbit Polyclonal Antibody
TA340407

USD 375.00

5 Days

Rabbit Polyclonal Anti-NXNL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NXNL2 antibody: synthetic peptide directed towards the middle region of human NXNL2. Synthetic peptide located within the following region: SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHC