Primary Antibodies

Jump to Filters
View as table Download
OR1N1 (C-term) Rabbit Polyclonal Antibody
AP31165PU-N

USD 440.00

2 Weeks

OR1N1 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC
Reactivities Human
Immunogen OR1N1 antibody was raised against synthetic peptide
OR1N1 Rabbit Polyclonal Antibody
TA337483

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR1N1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR1N1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR1N1. Synthetic peptide located within the following region: PPSIASEEKDIAAAAMYTIVTPMLNPFIYSLRNKDMKGALKRLFSHRSIV