Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RAD21 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFEN

Rabbit Polyclonal Anti-RAD21 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rad21 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG

Rabbit polyclonal anti-RAD21 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD21.

Rad21 Rabbit polyclonal Antibody

Applications ChIP, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Rad21 .

Rad21 Rabbit monoclonal Antibody

Applications IF, IHC, WB
Reactivities Hamster, Human
Conjugation Unconjugated