Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8
Applications | SISCAPA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8
Applications | SISCAPA |
Reactivities | Human |
Conjugation | Unconjugated |
SLC4A1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC4A1 |
Band 3 / AE1 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SLC4A1 / Band 3 / AE1 antibody was raised against synthetic peptide from human SLC4A1 / Band 3. |
Rabbit Polyclonal Anti-SLC4A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC4A1 antibody: synthetic peptide directed towards the N terminal of human SLC4A1. Synthetic peptide located within the following region: PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR |
Rabbit Polyclonal Anti-SLC4A1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC4A1 |
SLC4A1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-353 of human SLC4A1 (NP_000333.1). |