Primary Antibodies

Jump to Filters
View as table Download
TC2N (N-term) Rabbit Polyclonal Antibody
AP54137PU-N

USD 450.00

2 Weeks

TC2N (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 9~39 amino acids from the N-terminal region of human TAC2N
TC2N Rabbit Polyclonal Antibody
TA338817

USD 375.00

5 Days

Rabbit Polyclonal Anti-TC2N Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TC2N antibody: synthetic peptide directed towards the middle region of human TC2N. Synthetic peptide located within the following region: SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ