Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
TRPM4 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1120-1149 amino acids from the C-terminal region of human TRPM4 |
Rabbit Polyclonal Anti-TRPM4 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI |
Rabbit Polyclonal Anti-TRPM4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TRPM4 antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human TRPM4. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (94%); Elephant, Dog, Bat (89%); Marmoset, Mouse, Rat, Hamster, Panda, Bovine (83%). |
Rabbit Polyclonal Anti-TRPM4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TRPM4 antibody was raised against synthetic 16 amino acid peptide from internal region of human TRPM4. Percent identity with other species by BLAST analysis: Human, Gorilla, Mouse, Rat, Bovine (100%); Gibbon (94%); Panda, Dog (88%); Elephant (81%). |
Rabbit Polyclonal Anti-TRPM4 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TRPM4 antibody was raised against synthetic 17 amino acid peptide from N-Terminus of human TRPM4. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Orangutan, Monkey, Mouse (94%); Gibbon, Galago, Rat, Dog (88%); Marmoset, Elephant, Panda, Bovine, Pig (82%). |
TRPM4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human TRPM4 (NP_060106.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TRPM4
Antibody Hosts
- Rabbit