Primary Antibodies

Jump to Filters
View as table Download
AK6 Rabbit Polyclonal Antibody
TA336079

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAF9 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF9 Antibody: synthetic peptide directed towards the N terminal of human TAF9. Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD