Primary Antibodies

Jump to Filters
View as table Download
FBXO11 Rabbit Polyclonal Antibody
TA330471

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXO11 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO11 antibody: synthetic peptide directed towards the middle region of human FBXO11. Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ