Primary Antibodies

Jump to Filters
View as table Download
Smarca1 Rabbit Polyclonal Antibody
TA329969

USD 310.00

5 Days

Rabbit Polyclonal Anti-SMARCA1 Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1. Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS