Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BRD4 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BRD4 antibody: synthetic peptide directed towards the C terminal of human BRD4. Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS

BRD4 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 700-794 of human BRD4 (NP_001317313.1).