Primary Antibodies

Jump to Filters
View as table Download
SRPR beta (SRPRB) Rabbit Polyclonal Antibody
TA338465

USD 375.00

5 Days

Rabbit Polyclonal Anti-SRPRB Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the middle region of human SRPRB. Synthetic peptide located within the following region: QDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLYSSSTAPAQLGKKGKE
SRPR beta (SRPRB) Rabbit Polyclonal Antibody
TA382011

USD 220.00

3 Weeks

SRPRB Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 57-271 of human SRPRB (NP_067026.3).
Modifications Unmodified