Primary Antibodies

Jump to Filters
View as table Download
PNR (TAAR5) Rabbit Polyclonal Antibody
TA308699

USD 415.00

5 Days

Rabbit Polyclonal antibody to TAAR5 (trace amine associated receptor 5)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 273 and 337 of TAAR5 (Uniprot ID#O14804)
PNR (TAAR5) Rabbit Polyclonal Antibody
TA342677

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAAR5 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the C terminal of human TAAR5. Synthetic peptide located within the following region: TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP
PNR (TAAR5) Rabbit Polyclonal Antibody
TA342678

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAAR5 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR5 antibody: synthetic peptide directed towards the middle region of human TAAR5. Synthetic peptide located within the following region: GWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKA