Primary Antibodies

Jump to Filters
View as table Download
GATA2 Rabbit Polyclonal Antibody
TA329422

USD 310.00

5 Days

Rabbit Polyclonal anti-GATA2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2. Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA