Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TAAR6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR6. Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA

Mouse monoclonal anti-LGR4 antibody

Applications IHC
Reactivities Chimpanzee, Human, Macaque
Conjugation Unconjugated