Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GSTM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM2 antibody: synthetic peptide directed towards the N terminal of human GSTM2. Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF

GSTM2 mouse monoclonal antibody, clone 1E10, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse