Primary Antibodies

Jump to Filters
View as table Download
ELOB Rabbit Polyclonal Antibody
TA329241

USD 375.00

5 Days

Rabbit Polyclonal anti-TCEB2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCEB2 antibody: synthetic peptide directed towards the middle region of human TCEB2. Synthetic peptide located within the following region: TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ