Primary Antibodies

Jump to Filters
View as table Download
ABHD5 Rabbit Polyclonal Antibody
TA344120

USD 475.00

5 Days

Rabbit Polyclonal Anti-ABHD5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the C terminal of human ABHD5. Synthetic peptide located within the following region: SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK
ABHD5 Mouse Monoclonal Antibody [Clone ID: 1F3]
AM31371PU-N

USD 480.00

2 Weeks

ABHD5 mouse monoclonal antibody, clone 1F3, Purified

Applications ELISA, IHC, WB
Reactivities Human
ABHD5 Rabbit Polyclonal Antibody
TA321845

USD 345.00

4 Weeks

Anti-ABHD5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 297 amino acids of human abhydrolase domain containing 5
ABHD5 Rabbit Polyclonal Antibody
TA321844

USD 345.00

In Stock

Anti-ABHD5 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 297 amino acids of human abhydrolase domain containing 5