Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-FOXG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXG1A antibody: synthetic peptide directed towards the N terminal of human FOXG1A. Synthetic peptide located within the following region: GAPEGQRQLAQGDRRGRGICPVGPDEKEKARAGGEEKKGAGEGGKDGEGG |
Rabbit Polyclonal Anti-FOXG1B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOXG1B antibody: synthetic peptide directed towards the N terminal of human FOXG1B. Synthetic peptide located within the following region: MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHH |
