Primary Antibodies

View as table Download

SIM1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SIM1

Rabbit Polyclonal Anti-SIM1 Antibody

Applications IHC
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIM1 Antibody is: synthetic peptide directed towards the middle region of Human SIM1. Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR

SIM1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SIM1