Primary Antibodies

Jump to Filters
View as table Download
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 424.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA349352

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A
C1QC Rabbit Polyclonal Antibody
TA324448

USD 450.00

5 Days

Rabbit polyclonal C1QC Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC.
IL6 Rabbit Polyclonal Antibody
TA328217

USD 285.00

5 Days

Anti-Human IL-6 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-6
Complement Component 6 (C6) Rabbit Polyclonal Antibody
TA313533

USD 345.00

4 Weeks

Rabbit polyclonal anti-C6 (complement component 6) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C6.
C1QC Rabbit Polyclonal Antibody
TA326232

USD 345.00

4 Weeks

Rabbit polyclonal C1QC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human C1QC.
RANTES (CCL5) Rabbit Polyclonal Antibody
TA328432

USD 285.00

5 Days

Anti-Human RANTES Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human RANTES (CCL5)
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA328201

USD 285.00

5 Days

Anti-Human IL-1alpha Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-1alpha
Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody
TA334645

USD 375.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA
Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody
TA334646

USD 375.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL
C1QB Rabbit Polyclonal Antibody
TA335243

USD 375.00

5 Days

Rabbit Polyclonal Anti-C1QB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QB antibody: synthetic peptide directed towards the C terminal of human C1QB. Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
IL6 Rabbit Polyclonal Antibody
TA341223

USD 425.00

5 Days

Rabbit Polyclonal Anti-IL6 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen IL6 antibody was raised against synthetic 18 amino acid peptide from internal region of human IL-6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%).
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA321162

USD 345.00

In Stock

Anti-IL1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein