Primary Antibodies

Jump to Filters
View as table Download
NPY1R Rabbit Polyclonal Antibody
TA346235

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-NPY1R Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI
NPY1R Rabbit Polyclonal Antibody
TA327524

USD 345.00

3 Weeks

Rabbit anti-NPY1R Polyclonal Antibody

Applications IHC, WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human NPY1R
NPY1R Rabbit Polyclonal Antibody
TA321232

USD 345.00

4 Weeks

Anti-NPY1R rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1
NPY1R Rabbit Polyclonal Antibody
TA321233

USD 345.00

4 Weeks

Anti-NPY1R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1