Rabbit Polyclonal Anti-RPL8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL8 antibody: synthetic peptide directed towards the C terminal of human RPL8. Synthetic peptide located within the following region: KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM |
Rabbit Polyclonal Anti-RPL8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL8 antibody: synthetic peptide directed towards the C terminal of human RPL8. Synthetic peptide located within the following region: EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN |
RPL8 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RPL8 |
RPL8 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-257 of human RPL8 (NP_000964.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
