HNF4A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNF4A |
HNF4A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNF4A |
Rabbit polyclonal HNF4A Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
Goat Polyclonal Antibody against HNF4A
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1. |
Rabbit Polyclonal Anti-HNF4A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF4A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNF4A |
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |