Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MASP2

MASP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MASP2