Primary Antibodies

Jump to Filters
View as table Download
SRP14 Rabbit Polyclonal Antibody
TA345831

USD 410.00

5 Days

Rabbit Polyclonal Anti-SRP14 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP14 antibody: synthetic peptide directed towards the N terminal of human SRP14. Synthetic peptide located within the following region: KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL
SRP14 Rabbit Polyclonal Antibody
TA382004

USD 220.00

3 Weeks

SRP14 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human SRP14 (NP_003125.3).
Modifications Unmodified