Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SSTR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSTR1 antibody: synthetic peptide directed towards the C terminal of human SSTR1. Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD

Rabbit Polyclonal Anti-SSTR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SSTR1 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human SSTR1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Sheep, Goat, Bovine, Bat, Horse, Rabbit, Pig (100%); Hamster, Elephant (95%).

Anti-SSTR1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1

Anti-SSTR1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1