Primary Antibodies

Jump to Filters
View as table Download
Kv1.8 (KCNA10) Rabbit Polyclonal Antibody
TA338556

USD 310.00

5 Days

Rabbit Polyclonal Anti-KCNA10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the middle region of human KCNA10. Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW
Kv1.8 (KCNA10) Rabbit Polyclonal Antibody
TA338555

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNA10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10. Synthetic peptide located within the following region: DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI