Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Glutathione Peroxidase 3 (GPX3) (102-114) goat polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from internal region of human GPX3