Primary Antibodies

View as table Download

Rabbit anti-PRDM14 Polyclonal Antibody

Applications ChIP, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRDM14

Rabbit Polyclonal Anti-PRDM14 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRDM14 Antibody: synthetic peptide directed towards the middle region of human PRDM14. Synthetic peptide located within the following region: GVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQ

Rabbit Polyclonal Anti-PRDM14 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PRDM14