Primary Antibodies

Jump to Filters
View as table Download
Hyaluronidase PH20 (SPAM1) Rabbit Polyclonal Antibody
TA327282

USD 275.00

2 Weeks

Rabbit anti-SPAM1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SPAM1
HEXB Rabbit Polyclonal Antibody
TA314004

USD 345.00

4 Weeks

Rabbit polyclonal anti-HEXB antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.
beta glucuronidase (GUSB) Rabbit Polyclonal Antibody
TA334656

USD 310.00

5 Days

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
GNS Rabbit Polyclonal Antibody
TA356470

USD 360.00

5 Days

GNS Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GNS